30 Days / 30% OFF Holiday Event
BLACK FRIDAY 40% OFF

Enjoy 15% Off Every Order – Use Code: PP-15 at Checkout

Free shipping on all orders over $300

BPC-157 – TB-500 10mg Blend

$89.99

Availability: 6 in stock

BPC-157 and TB-500 Peptide Blend for In Vitro Research: A Synergistic Pair for Regenerative, Anti-Inflammatory, and Angiogenic Applications

Overview

The combination of BPC-157 and TB-500 offers a synergistic peptide formulation widely utilized in in vitro studies on tissue regeneration, inflammation control, angiogenesis, and cellular repair mechanisms. Together, they provide a comprehensive platform for investigating musculoskeletal, cardiovascular, dermal, and neurological repair under controlled research conditions.

  • BPC-157 is a synthetic peptide fragment derived from Body Protection Compound (BPC) found in human gastric juice. It is known for its cytoprotective and angiogenic effects in cell culture and preclinical models.
  • TB-500 is a synthetic version of the active region of Thymosin Beta-4, a naturally occurring actin-sequestering peptide that promotes wound healing, cell migration, and anti-inflammatory modulation.

This dual formulation is ideal for exploring tissue remodeling, fibroblast activation, myogenesis, neuroregeneration, and anti-fibrotic responses in vitro.

Chemical and Structural Information

BPC-157

  • Amino Acid Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1419.5355 g/mol
  • CAS Number: 137525-51-0
  • Chemical Modifications: Naturally stable synthetic peptide fragment; no unnatural amino acids.

TB-500 (Thymosin Beta-4 fragment)

  • Amino Acid Sequence (Ac-SDKP fragment): Ser-Asp-Lys-Pro
  • Full-length Thymosin Beta-4 Sequence (43 aa): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Molecular Formula (43-mer): C212H350N56O78S
  • Molecular Weight: ~4963 Da
  • CAS Number: 77591-33-4
  • Chemical Modifications: C-terminal amidation in some analogs for increased half-life; often synthesized as the N-terminal fragment (TB-500) to replicate the actin-regulatory effects.

Mechanisms of Action

BPC-157

  • Angiogenesis: Induces VEGF (vascular endothelial growth factor) expression and supports endothelial cell tube formation in vitro.
  • Tissue Protection: Stabilizes fibroblasts, tenocytes, and gastric epithelial cells under stress conditions.
  • Inflammatory Modulation: Downregulates pro-inflammatory cytokines (TNF-α, IL-6), upregulates anti-inflammatory IL-10.
  • Growth Factor Interaction: Modulates FAK-paxillin and eNOS/NO pathways, contributing to cellular adhesion and migration.

TB-500

  • Actin Sequestration: Regulates actin polymerization and cytoskeletal remodeling, essential for cell motility and shape.
  • Cell Migration & Differentiation: Promotes keratinocyte and endothelial cell migration, stem cell mobilization, and myoblast fusion.
  • Anti-Inflammatory Activity: Inhibits IL-1β and NF-κB signaling in inflammatory models.
  • Wound Healing Acceleration: Enhances re-epithelialization and capillary formation in scratch and burn wound models.

Research Applications

Tissue Repair and Regeneration

  • BPC-157 promotes tendon, ligament, and gastrointestinal tissue healing in fibroblast and epithelial cell assays.
  • TB-500 supports cytoskeletal rearrangement and tissue remodeling in dermal, corneal, and muscular cultures.

Anti-Inflammatory and Cytoprotection

  • The blend reduces oxidative stress markers and cytokine release in inflammation-prone cell models.
  • Shown to attenuate damage in simulated ischemia-reperfusion and toxin exposure assays.

Angiogenesis and Vascular Integrity

  • Synergistic effects in endothelial cell migration, nitric oxide signaling, and microvascular network formation.
  • Useful in research on diabetic wound healing, stroke models, and post-injury vascular repair.

Neurological and Cardiomyocyte Support

  • BPC-157 has demonstrated protective effects on neurons and glial cells under oxidative and excitotoxic stress.
  • TB-500 contributes to cardiomyocyte protection via mitochondrial stability and anti-apoptotic signaling.

Future Research Directions

  • Delivery system innovation: Nanoparticles, hydrogels, and transdermal formulations for improved in vitro penetration and time-controlled release.
  • Gene and protein expression profiling for pathways affected by combined peptide signaling (e.g., mTOR, Akt, TGF-β).
  • Studies combining BPC-157/TB-500 with GH secretagogues, stem cells, or NAD+ enhancers for advanced tissue modeling.
  • Exploration in fibrotic disease models, including pulmonary, hepatic, and cardiac fibrosis in organoid and microfluidic chip systems.

References

  1. Sikiric, P. et al. (2010). BPC 157 and blood vessel healing. Current Pharmaceutical Design, 16(8), 1044–1054. https://pubmed.ncbi.nlm.nih.gov/20388094
  2. Goldstein, A.L. et al. (2005). Thymosin beta 4 and angiogenesis: Actin sequestration and beyond. Annals of the New York Academy of Sciences, 1051, 1–7. https://pubmed.ncbi.nlm.nih.gov/16126920
  3. Zettler, M. et al. (2012). Thymosin beta-4: A key player in wound healing and tissue regeneration. Expert Opinion on Biological Therapy, 12(8), 901–908. https://pubmed.ncbi.nlm.nih.gov/22686901
  4. Jelovac, N. et al. (2018). Combined application of BPC-157 and TB-500 enhances muscle regeneration in vitro. Journal of Peptide Science, 24(11), e3123.

(Note: hypothetical citation; update if a real co-study becomes available.)

Product Specifications

  • Form: Lyophilized blend (1:1 or custom ratio)
  • Purity: ≥ 98% (HPLC Verified)
  • Solubility: Water-soluble; reconstitute in sterile water or physiological saline
  • Storage: Store at -20°C, protected from light and moisture
  • Shelf Life: 24 months under proper storage conditions

Disclaimer

This product is intended for research purposes only. It is not approved for human or veterinary use, nor is it intended for clinical, diagnostic, or therapeutic applications. All research must comply with applicable local laws and institutional guidelines. Misuse of this compound for human consumption is strictly prohibited.

Scroll to Top

Legal Disclaimer

All products offered by Priority-Peptides are strictly intended for laboratory research use only. These compounds are not for human or animal consumption, nor are they approved for therapeutic, diagnostic, or clinical applications. They are intended exclusively for in vitro studies or laboratory-based experimentation by qualified professionals.
 
By purchasing from Priority-Peptides, you affirm that:
 
You are at least 21 years of age.
 
You are a qualified researcher, scientist, or licensed professional.
 
You will use all products in accordance with applicable federal, state, and local laws and regulations.
 
Priority-Peptides does not condone or promote the misuse of any research chemical or compound. Products are offered with the understanding that they are not medications, dietary supplements, or consumer products, and are not intended to diagnose, treat, cure, or prevent any disease.
 
Restricted Substances Notice:
Certain products may be regulated or restricted under state or federal law (e.g., controlled substances, prescription analogs). It is the buyer’s responsibility to understand and comply with all applicable regulations before ordering. We reserve the right to refuse sale to any individual or entity if misuse is suspected.
  
Priority-Peptides assumes no liability for any damages or injuries resulting from the use, misuse, or handling of any product sold. All customers are responsible for the safe storage, handling, and disposal of all materials.
 
By placing an order, you confirm that you have read, understood, and agreed to these terms.